--- /dev/null
+version 5.3
+" ==================================================================
+" File: $HOME/.vimrc
+" Availability: This file is available as
+" ~20K <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc.gz>
+" ~56K <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc>
+" <URL:http://www.vim.org/rc> (mirror)
+" Size: This file is about 57K in size and has 1,500+ lines.
+" Purpose: Setup file for the editor Vim (Vi IMproved)
+" Author: Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de)
+" <URL:http://www.math.fu-berlin.de/~guckes/sven/>
+" Related files:
+" http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim
+" http://www.math.fu-berlin.de/~guckes/vim/src/html.vim
+" http://www.math.fu-berlin.de/~guckes/vim/syntax/
+" Note: Please send comments to me - email preferred! :-)
+" Last update: Thu Dec 10 02:02:02 CET 1998
+" ===================================================================
+" The latest versions of Vim are usually in my signature file:
+" http://www.math.fu-berlin.de/~guckes/sig/SIGS Have a look!
+" ===================================================================
+" Note to Windows users: Get these files from any Vim mirror:
+" vim52rt.zip (840K) vim runtime files (docs + syntax files)
+" gvimw32.zip (440K) gvim - precompiled binary for Windows 32bit
+" These should fit onto one floppy. Just a recommendation.
+" ===================================================================
+" Installation of this setup file:
+"
+" To use this setup file, copy it to
+" this filename on these systems:
+" ~/.vimrc Unix and OS/2
+" s:.vimrc Amiga
+" $VIM\_vimrc MS-DOS and Win32
+"
+" NOTE: This setup file uses a lot of features of Vim-5.
+" If you are still using Vim-4 (or an even older version)
+" then you should upgrade - it is really worth the effort!
+" To find out why get Vim-5 and read ":help version5".
+"
+" The first line of this setup file contains the information
+" "version xxx" which allows VIM to check whether the setup file
+" fits the syntax that it understands.
+" Versions of VIM other than of version 5 then will give a warning
+" as they do not understand this setup file command - a feature:
+" Give a warning so the user knows that there is something odd
+" about the setup file.
+" ===================================================================
+" Whitespace meta sequence:
+" vim-5.0s introduced the meta sequence "\s" which stands for "whitespace"
+" ie either a space or a tab. This makes mappings a lot easier.
+" I have therefore updated my mappings to use this sequence.
+" But this is incompatible with previous versions and, of course, Vi.
+" ===================================================================
+" Info on the latest versions is on the Vim HomePage:
+" http://www.vim.org/ - which is a daily mirror of the pages at
+" http://www.math.fu-berlin.de/~guckes/vim/
+" and in Sven's signature file:
+" http://www.math.fu-berlin.de/~guckes/sig/SIGS
+" ===================================================================
+" ===================================================================
+" Structure of this file:
+" Lines starting with an inverted comma (") are comments.
+" Some mappings are commented out. Remove the comment to enable them.
+"
+" There are three kinds of things which are defined in this file:
+" Mapping ("map"), settings ("set"), and abbreviations ("ab").
+" Settings affect the behaviour of commands.
+" Mappings maps a key sequence to a command.
+" Abbreviations define words which are replaced
+" right *after* they are typed in.
+"
+" ===================================================================
+" Note on mappings - "angle notation" (see ":help <>"):
+" VIM allows you to define mappings with special characters
+" with a notation that uses non-special characters:
+" The notation encloses decriptive words in angle brackets (<>).
+" The characters you will most often are:
+" <C-M> for control-m
+" <C-V> for control-v which quotes the following character
+" <ESC> for the escape character.
+" All control characters have been replaced to use the angle notation
+" so you should be able to read this file without problems.
+" (Well, sometimes I leave some tabs [control-i] in the file. ;-)
+" ===================================================================
+" External programs:
+" Some mappings make use of external programs.
+" The following you should find on every UNIX system:
+" awk, egrep, grep, ispell, perl, sed.
+" If you are using DOS then you should get these for you system!!
+" Programs that are supplied with the mailer ELM: elmalias, readmsg.
+" To get these look at page
+" http://www.math.fu-berlin.de/~guckes/elm/dist.html
+" One major advantage of vim-5 (actually, 5.0g) is that there is now
+" the internal function "strftime". This allows to insert the current
+" date and time in various format. Example: mapping ",L" (see below)
+" ===================================================================
+" SETtings
+" ===================================================================
+"
+" autoindent: "off" as I usually do not write code.
+ set noautoindent
+"
+" autowrite: "on" saves a lot of trouble
+ set autowrite
+"
+" backup: backups are for wimps ;-)
+ set nobackup
+"
+" backspace: '2' is much smarter.
+ set backspace=2
+"
+" background: Are we using a "light" or "dark" background?
+ set background=dark
+"
+" compatible ....
+ set nocompatible
+"
+" comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:-
+ set comments=b:#,:%,fb:-,n:>,n:)
+"
+" cpoptions you should get to know - source of many FAQs! ;-)
+" cpoptions: "compatible options" to match Vi behaviour
+" set cpoptions="aABceFs" "default!
+" FAQ: Do NOT include the flag '<' if you WANT angle notation!
+"
+" dictionary: english words first
+ set dictionary=/usr/dict/words,/local/lib/german.words
+"
+" digraph: required for those umlauts
+ set digraph
+"
+" errorbells: damn this beep! ;-)
+ set noerrorbells
+
+" esckeys: allow usage of cursor keys within insert mode
+ set esckeys
+"
+" formatoptions: Options for the "text format" command ("gq")
+" I need all those options (but 'o')!
+ set formatoptions=cqrt
+"
+" helpheight: zero disables this.
+ set helpheight=0
+"
+" helpfile: filename of the helpfile
+" set helpfile=c:\\vim-4.6\\docs\\help.txt
+" this is where I usually put it on DOS; sometimes is required
+" to set as the default installation does not find it :-(
+"
+" hidden:
+ set hidden
+"
+" highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws
+ set highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws
+"
+" hlsearch : highlight search - show the current search pattern
+" This is a nice feature sometimes - but it sure can get in the
+" way sometimes when you edit.
+ set nohlsearch
+"
+" icon: ...
+ set noicon
+"
+" set iconstring file of icon (Sven doesn't use an icon)
+" set iconstring
+"
+" ignorecase: ignore the case in search patterns? NO!
+ set noignorecase
+"
+" insertmode: start in insert mode? Naah.
+ set noinsertmode
+"
+"
+" iskeyword: Add the dash ('-'), the dot ('.'), and the '@'
+" as "letters" to "words".
+" iskeyword=@,48-57,_,192-255 (default)
+ set iskeyword=@,48-57,_,192-255,-,.,@-@
+"
+" joinspaces: insert two spaces after a period with every
+" joining of lines. This is very nice!
+ set joinspaces
+"
+" keywordprg: Program to use for the "K" command.
+" set keywordprg=man\ -s
+"
+" laststatus: show status line? Yes, always!
+" laststatus: Even for only one buffer.
+ set laststatus=2
+"
+" [VIM5]lazyredraw: do not update screen while executing macros
+ set lazyredraw
+"
+" magic: use some magic in search patterns? Certainly!
+ set magic
+"
+" modeline: ...
+" Allow the last line to be a modeline - useful when
+" the last line in sig gives the preferred textwidth for replies.
+ set modeline
+ set modelines=1
+"
+" number: ...
+ set nonumber
+"
+" path: The list of directories to search when you specify
+" a file with an edit command.
+" Note: "~/.P" is a symlink to my dir with www pages
+" "$VIM/syntax" is where the syntax files are.
+ set path=.,,~/.P/vim,~/.P/vim/syntax,~/.P/vim/source,$VIM/syntax/
+" set path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn
+"
+" report: show a report when N lines were changed.
+" report=0 thus means "show all changes"!
+ set report=0
+"
+" ruler: show cursor position? Yep!
+ set ruler
+"
+" Setting the "shell" is always tricky - especially when you are
+" trying to use the same vimrc on different operatin systems.
+" shell for DOS
+" set shell=command.com
+" shell for UNIX - math.fu-berlin.de BSD
+" set shell=zsh
+" shell for UNIX - inf.fu-berlin.de BSD&Solaris
+" set shell=zsh
+" shell for UNIX - zedat.fu-berlin.de BSD&Solaris
+" set shell=/bin/tcsh
+" zsh now available at zedat! :-)
+" set shell=zsh
+" Now that vim-5 has ":if" I am trying to automate the setting:
+"
+ if has("dos16") || has("dos32")
+ let shell='command.com'
+ endif
+ if has("unix")
+ let shell='zsh'
+ endif
+"
+" shiftwidth: Number of spaces to use for each
+" insertion of (auto)indent.
+ set shiftwidth=8
+"
+" shortmess: Kind of messages to show. Abbreviate them all!
+" New since vim-5.0v: flag 'I' to suppress "intro message".
+ set shortmess=at
+"
+" showcmd: Show current uncompleted command? Absolutely!
+ set showcmd
+"
+" showmatch: Show the matching bracket for the last ')'?
+ set showmatch
+"
+" showmode: Show the current mode? YEEEEEEEEESSSSSSSSSSS!
+ set showmode
+"
+" suffixes: Ignore filename with any of these suffixes
+" when using the ":edit" command.
+" Most of these are files created by LaTeX.
+ set suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar
+"
+" startofline: no: do not jump to first character with page
+" commands, ie keep the cursor in the current column.
+ set nostartofline
+"
+" tabstop
+ set tabstop=8
+"
+"
+" Set the colors for vim on "xterm"
+ if &term=="xterm"
+ set t_Co=8 " "terminal has eight colors"
+ set t_Sb=\e[4%dm " escape sequence for background
+ set t_Sf=\e[3%dm " escape sequence for foreground
+" source ~/.P/vim/syntax/colors.vim
+" http://www.math.fu-berlin.de/~guckes/vim/syntax/colors.vim
+" [todo] Add this to the Vim FAQ
+ endif
+"
+" textmode: no - I am using Vim on UNIX!
+ set notextmode
+"
+" textwidth
+ set textwidth=79
+"
+" title:
+ set notitle
+"
+" ttyfast: are we using a fast terminal?
+" seting depends on where I use Vim...
+ set nottyfast
+"
+" ttybuiltin:
+ set nottybuiltin
+"
+" ttyscroll: turn off scrolling -> faster!
+ set ttyscroll=0
+"
+" ttytype:
+" set ttytype=rxvt
+"
+" viminfo: What info to store from an editing session
+" in the viminfo file; can be used at next session.
+ set viminfo=%,'50,\"100,:100,n~/.viminfo
+"
+" visualbell:
+ set visualbell
+"
+" t_vb: terminal's visual bell - turned off to make Vim quiet!
+" Please use this as to not annoy cow-orkers in the same room.
+" Thankyou! :-)
+ set t_vb=
+"
+" whichwrap:
+ set whichwrap=<,>
+"
+" wildchar the char used for "expansion" on the command line
+" default value is "<C-E>" but I prefer the tab key:
+ set wildchar=<TAB>
+"
+" wrapmargin:
+ set wrapmargin=1
+"
+" writebackup:
+ set nowritebackup
+"
+" ===================================================================
+" ABbreviations
+" ===================================================================
+" 980701: Moved the abbreviations *before* the mappings as
+" some of the abbreviations get used with some mappings.
+"
+" Abbreviations for some important numbers:
+ iab Npi 3.1415926535897932384626433832795028841972
+ iab Ne 2.7182818284590452353602874713526624977573
+"
+" Abbreviations for some classic long words:
+"
+" Donau... is the German word for the (read in reverse)
+" "additional paragraph of the law regulating the pension of
+" widows to captains of the ship company on (the river) Danube"
+" (I am not making this up! ;-)
+ iab YDD Donaudampfschiffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph
+"
+" YLL : The name of a town in Wales. I am not making this up!
+ iab YLL LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
+" http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk
+" http://194.159.85.168/ - I am not making this up! :-)
+"
+" YTauma: The name of a hill in New Zealand.
+ iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu
+"
+" Yalpha : The lower letter alphabet.
+ iab Yalpha abcdefghijklmnopqrstuvwxyz
+"
+" YALPHA : The upper letter alphabet.
+ iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ
+"
+" Ydigit : The ten digits.
+ iab Ydigit 1234567890
+"
+" Yruler : A ruler.
+ iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
+"
+" Yupsidedown : This describes people from "down under"
+" (Hi, Dean!).
+ iab Yupsidedown umop-ap!sdn
+"
+" Ysuper: A nice long word from the musical "Mary Poppins".
+ iab Ysuper supercalifragilisticexpialidocious
+
+" Yanti: The longest proper word in the English language?!
+ iab Yanti antidisestablishmentarianism
+"
+" Ypass : Standard answer to Usenet posts
+" with the "Subject: HELP" (hehe)
+ iab Ypass "You are in a maze of twisty little passages, all alike."
+"
+" Ysesqui : "Sesquipedalophobia" means "fear of big words." ;-)
+ iab Ysesqui sesquipedalophobia
+"
+" classic pangrams (which include every letter of the alphabet):
+" German:
+" sylvia wagt quick den jux bei pforzheim
+" bayerische jagdwitze von maxl querkopf
+" zwei boxkaempfer jagen eva quer durch sylt
+" kaufen sie jede woche vier gute bequeme pelze
+" falsches üben von xylophonmusik quält jeden größeren zwerg.
+" Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch!
+" English:
+" the quick brown fox jumps over the lazy dog
+" French:
+" voyez le brick geant que j'examine pres du wharf.
+"
+" And a sentence to break some quoing levels:
+" "This man's house (which 's yellow) burned down."
+"
+" And now for something completely different:
+" I couldn't bear to bear bears over the border.
+"
+" Inserting an ellipsis to indicate deleted text
+ iab Yell [...]
+ vmap ,ell c[...]<ESC>
+"
+" Correcting those typos. [I almost never get these right. :-(]
+" See also: http://www.igd.fhg.de/~zach/programs/acl/
+ iab alos also
+ iab aslo also
+ iab charcter character
+ iab charcters characters
+ iab exmaple example
+ iab shoudl should
+ iab seperate separate
+ iab teh the
+" Some frequent typos in German:
+ iab nciht nicht
+ iab doer oder
+ iab Dreckfuhler Druckfehler
+" Sorry, Laurent!
+ iab Laurant Laurent
+"
+" See http://www.math.fu-berlin.de/~guckes/sig/:
+ iab YDDS dash-dash-space
+"
+" For reports and texts on my studies:
+ iab YKT Komplexitaetstheorie
+ iab YRA Rechnerarchitektur
+ iab YPM Pattern Matching
+" see http://elib.zib.de/ICM98 :
+ iab YICM International Congress of Mathematicians
+"
+" Some sentences that I really use often in emails about Vim:
+ iab YAW You are welcome! :-)
+ iab YEV Enjoy Vim!
+"
+" Often used filenames - only needed these on the command line:
+" see also: http://www.math.fu-berlin.de/~guckes/setup/
+"
+ cab ELMALIAS ~/.elm/aliases.text
+ cab Erc ~/.elm/elmrc
+ cab Mrc ~/.muttrc
+ cab Src ~/.slrnrc
+ cab Zrc ~/.zsh/.zshrc
+ cab SIGs ~/.P/sig/SIGS
+"
+" A list of filenames that are needed to shorten some autocommands:
+" cab MAILNEWSFILES .article,.followup,.letter,mutt*[0-9],/postpone/*
+" cab MAILNEWSFILES *.article,*.followup,*.letter,*mutt*
+let MAILNEWSFILES = "*.article,*.followup,*.letter,mutt*"
+"
+" see also: http://www.math.fu-berlin.de/~guckes/sig/SIGS
+"
+" Email Adresses:
+" I usually use these when adding addresses to the header
+" of emails (mutt) and posts (slrn).
+"
+" Author of the Good NetKeeping Seal of Approval:
+ ab Agnksa js@xs4all.nl (Jeroen Scheerder)
+"
+" Author of Mutt:
+ ab Amutt me@cs.hmc.edu (Michael Elkins)
+"
+" Author of Slrn:
+ ab Aslrn davis@space.mit.edu (John E. Davis)
+"
+" Author of Vim:
+" ab Avim mool@oce.nl (Bram Moolenaar)
+ ab Avim bram@vim.org (Bram Moolenaar)
+"
+" Former Maintainer of the Vim FAQ:
+ ab Avimfaq laurent@Grafnetix.COM (Laurent Duperval)
+"
+" Mailing Lists (MLs)
+"
+" The Vim mailing lists: See http://www.vim.org/mail.html for more info!
+ ab MLvim vim@vim.org (VIM Help List)
+ ab MLvimdev vim-dev@vim.org (VIM Development List)
+ ab MLvimmac guckes-vimmac@math.fu-berlin.de (VIM on MacOS Development List)
+"
+" More mailing lists:
+ ab MLgnksa gnksa-workers@babayaga.math.fu-berlin.de (GNKSA Workers List)
+ ab MLmuttdev mutt-dev@mutt.org (Mutt Developer List)
+ ab MLmuttuser mutt-users@mutt.org (Mutt Users List)
+ ab MLzsh zsh-users@math.gatech.edu (ZShell Users List)
+"
+"
+" News: newsgroup names
+"
+" Newsgroup about "warloding" of signatures - see
+" also http://www.math.fu-berlin.de/~guckes/afw/
+ iab Nafw alt.fan.warlord
+ iab Nahbou alt.humor.best-of-usenet
+ iab Nzedat bln.announce.fub.zedat.d
+ iab Ncsd bln.announce.fub.cs.d
+ iab Nce comp.editors
+" Newsgroup about "lynx":
+ iab Nhtml comp.infosystems.www.authoring.html
+" Newsgroup about "elm": Elm is dead - long live Mutt!
+ iab Nelm comp.mail.elm
+" Newsgroup about "pine": When will they release pine-4?
+" iab Ncmp comp.mail.pine
+ iab Npine comp.mail.pine
+" iab Ncsmd comp.sys.mac.digest
+" Newsgroup about "mobil phone systems":
+ iab Ndcm de.comm.mobil
+ iab Nmobil de.comm.mobil
+" Newsgroup about "web browsers":
+ iab Nlynx comp.infosystems.www.browsers.misc
+ iab Nnetscape comp.infosystems.www.browsers.misc
+" Newsgroup about "mutt" [since 980401]: The coolest mail user agent
+ iab Nmutt comp.mail.mutt
+" Newsgroup about "nn": Once was the best newsreader. Still good.
+ iab Nnn news.software.nn
+" Newsgroup for "newbies".
+" All you ever wanted to know - but were afraid to ask. ;-)
+ iab Newbie news.newusers.questions
+" Newsgroup about "newsreader *agents*" (netscape and slrn):
+ iab Nnsr news.software.readers
+"
+" Usenet header lines (used when composing a post):
+"
+ iab UFT Followup-To:
+ iab UMCT Mail-Copies-To: MYADDR
+ iab UNG Newsgroups:
+ iab URT Reply-To: MYADDR
+ iab UFUB Organization: Freie Universitaet Berlin
+"
+" Current version numbers of my favourite programs:
+" http://www.math.fu-berlin.de/~guckes/sig/SIGS
+" And some abbreviations to type them in mail&news:
+"
+ iab Velm ELM2.4PL25 [951204]
+ iab VElm ELM2.5b2 [980213]
+ iab Vlynx lynx-2.8.0 [980310
+ iab Vmutt mutt-0.92.8 [980514]
+ iab Vslrn slrn-0.9.5.2 [980503]
+ iab Vvim vim-5.1 [980407]
+ iab Vvimdev vim-5.2c [980518]
+"
+" For current version numbers take a look at my signature file:
+" http://www.math.fu-berlin.de/~guckes/sig/SIGS
+"
+" My snail mail address, phone numbers, and email->pager gateway:
+" Postcards and FAXes are welcome (especially with cartoons :-).
+" If you want, you can send a message to my pager by email, too.
+ iab Ypager To: ums@teco.edu<C-M>Subject: PAGE:01777777796
+ iab Yphone TEL/FAX (+49 30) 8838884<C-M>Cellphone (+49 177) 7777796
+ iab Ysnail Sven Guckes<C-M>Pariser Str. 52<C-M>D-10719 Berlin
+"
+" My addresses (Email and WWW)
+" makes it easy to type them without typos ;-)
+ ab Amaili guckes@inf.fu-berlin.de
+ ab Amailm guckes@math.fu-berlin.de
+ ab Amailv guckes@vim.org
+ ab Amailz guckes@zedat.fu-berlin.de
+ ab MYADDR guckes@math.fu-berlin.de
+ ab MYNAME Sven Guckes
+"
+" Setting the reply address when replying as the guy from SKB:
+ ab ASKB Sprachboerse <sprachboerse@tu-berlin.de>
+" See also: http://www.math.fu-berlin.de/~guckes/skb/
+"
+" My Home Pages at the departments at the FUB
+"
+ ab WWWm http://www.math.fu-berlin.de/~guckes/
+ ab WWWi http://www.inf.fu-berlin.de/~guckes/
+ ab WWWz http://userpage.zedat.fu-berlin.de/~guckes/
+"
+" WWW Pages base URLs
+"
+ ab HPA http://www.math.fu-berlin.de/~guckes/afw/
+ ab HPa http://www.math.fu-berlin.de/~guckes/ascii/
+ ab HPc http://www.math.fu-berlin.de/~guckes/calvin/
+ ab HPD http://www.math.fu-berlin.de/~guckes/dos/
+ ab HPe http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html
+ ab HPE http://www.math.fu-berlin.de/~guckes/elm/
+ ab HPI http://www.math.fu-berlin.de/~guckes/irc/
+ ab HPi http://www.math.fu-berlin.de/~guckes/ispell/
+ ab HPL http://www.math.fu-berlin.de/~guckes/lynx/
+ ab HPl http://www.math.fu-berlin.de/~guckes/less/
+ ab HPm http://www.math.fu-berlin.de/~guckes/mail/
+ ab HPM http://www.math.fu-berlin.de/~guckes/mutt/
+ ab HPN http://www.math.fu-berlin.de/~guckes/nn/
+ ab HPP http://www.math.fu-berlin.de/~guckes/pine/
+ ab HPp http://www.math.fu-berlin.de/~guckes/procmail/
+ ab HPr http://babayaga.math.fu-berlin.de/~rxvt/
+ ab HPR http://www.math.fu-berlin.de/~guckes/rfc/
+ ab HPs http://www.math.fu-berlin.de/~guckes/screen/
+ ab HPS http://www.math.fu-berlin.de/~guckes/slrn/
+ ab HPv http://www.math.fu-berlin.de/~guckes/vi/
+" HPOV - the "original" URL of the Vim Home Page!
+ ab HPOV http://www.math.fu-berlin.de/~guckes/vim/
+ ab HPV http://www.vim.org/
+ ab HPX http://www.math.fu-berlin.de/~guckes/xmas/
+ ab HPZ http://www.math.fu-berlin.de/~guckes/zsh/
+"
+" Other important WWW addresses
+"
+ ab URLutefuchs http://www.math.fu-berlin.de/~utefuchs/
+ ab URLaltavista http://altavista.digital.com/
+ ab URLftpsearch http://ftpsearch.ntnu.no/ftpsearch/
+ ab URLvimfaq http://www.grafnetix.com/~laurent/vim/faq.html
+ ab URLbambi http://www.math.fu-berlin.de/~leitner/CnH/bambi.html
+ ab URLsecret http://www.math.fu-berlin.de/~leitner/CnH/secret.html
+ ab URLwhome http://www.math.fu-berlin.de/~leitner/CnH/who.me.html
+ ab URLstopspam http://www.math.fu-berlin.de/~guckes/pics/stop.this.spam.jpg
+ ab FTPFUB ftp://ftp.fu-berlin.de/
+ ab FTPVIM ftp://ftp.fu-berlin.de/pub/misc/editors/vim/
+"
+" ===================================================================
+" Abbreviations - Header Lines for Email and News
+" ===================================================================
+" Define regexpr for headers to use with mappings
+" as it makes reading the mappings much easier:
+" cab HADDR From\\|Cc\\|To
+ cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\)
+ cab HNEWS ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\)
+"
+" ===================================================================
+" Abbreviations - General Editing - Inserting Dates and Times
+" ===================================================================
+"
+" First, some command to add date stamps (with and without time).
+" I use these manually after a substantial change to a webpage.
+" [These abbreviations are used with the mapping for ",L".]
+"
+ iab Ydate <C-R>=strftime("%y%m%d")<CR>
+" Example: 971027
+"
+ iab Ytime <C-R>=strftime("%H:%M")<CR>
+" Example: 14:28
+"
+ iab YDT <C-R>=strftime("%y%m%d %T")<CR>
+" Example: 971027 12:00:00
+"
+ iab YDATE <C-R>=strftime("%a %b %d %T %Z %Y")<CR>
+" Example: Tue Dec 16 12:07:00 CET 1997
+"
+" On Windows the functions "strftime" seems to have a different
+" format. Therefore the following may be necessary: [980730]
+" if !has("unix")
+" iab YDATE <C-R>=strftime("%c %a")<CR>
+" else
+" iab YDATE <C-R>=strftime("%D %T %a")<CR>
+" endif
+"
+" ===================================================================
+" MAPpings
+" ===================================================================
+" Caveat: Mapping must be "prefix free", ie no mapping must be the
+" prefix of any other mapping. Example: "map ,abc foo" and
+" "map ,abcd bar" will give you the error message "Ambigous mapping".
+"
+" The backslash ('\') is the only(?) unmapped key, so this is the best
+" key to start mappings with as this does not take away a command key.
+" However, the backslash is never in the same position with keyboards.
+" Eg on German keyboards it is AltGr-sz - don't ask.
+" Anyway, I have decided to start mappings with the comma as this
+" character is always on the same position on almost all keyboards
+" and I hardly have a need for that command.
+"
+" The following maps get rid of some basic problems:
+"
+" With Vim-4 the format command was just 'Q' and
+" I am too used to it. So I need this back!
+ nnoremap Q gq
+ vnoremap Q gq
+"
+" 980527 I often reformat a paragraph to fit some textwidth -
+" and I use the following mapping to adjust it to the
+" current position of the cursor:
+ map #tw :set textwidth=<C-R>=col(".")<C-M>
+"
+" 981210 Whenever I paste some text into VIM I have to
+" toggle from "nopaste" to "paste" and back again:
+" map <f4> :set paste!<c-m>:set paste?<c-m>
+ map <esc>[14~ :set paste!<c-m>:set paste?<c-m>
+"
+" "tal" is the "trailer alignment" filter program
+" Hopefully it will ship with Vim one day.
+" vmap #t !tal<CR>
+" vmap #t !tal -p 0<CR>
+"
+" Disable the command 'K' (keyword lookup) by mapping it
+" to an "empty command". (thanks, Lawrence! :-):
+" map K :<CR>
+ map K :<BS>
+"
+" Disable the suspend for ^Z.
+" I use Vim under "screen" where a suspend would lose the
+" connection to the " terminal - which is what I want to avoid.
+ map <C-Z> :shell
+"
+" Make CTRL-^ rebound to the *column* in the previous file
+ noremap <C-^> <C-^>`"
+"
+" Make "gf" rebound to last cursor position (line *and* column)
+ noremap gf gf`"
+"
+" When I let Vim write the current buffer I frequently mistype the
+" command ":w" as ":W" - so I have to remap it to correct this typo:
+ nmap :W :w
+"
+" Are you used to the Unix commands "alias" and "which"?
+" I sometimes use these to look up my abbreviations and mappings.
+" So I need them available on the command line:
+ map :alias map
+ map :which map
+"
+" The command {number}CTRL-G show the current nuffer number, too.
+" This is yet another feature that vi does not have.
+" As I always want to see the buffer number I map it to CTRL-G.
+" Pleae note that here we need to prevent a loop in the mapping by
+" using the comamnd "noremap"!
+ noremap <C-G> 2<C-G>
+"
+" 980311 Sourcing syntax files
+" My personal syntax files are in ~/.P/vim/syntax/
+" and I need a quick way to edit and source them.
+ map ,SO :so ~/.P/vim/syntax/
+"
+" 980706 Sourcing syntax files from the distribution
+" A nice and fast way to both source syntax files
+" and to take a look at "what's there":
+ map ,V :so $VIM/syntax/
+"
+" ===================================================================
+" Customizing the command line
+" ===================================================================
+" Valid names for keys are: <Up> <Down> <Left> <Right> <Home> <End>
+" <S-Left> <S-Right> <S-Up> <PageUp> <S-Down> <PageDown> <LeftMouse>
+"
+" Many shells allow editing in "Emacs Style".
+" Although I love Vi, I am quite used to this kind of editing now.
+" So here it is - command line editing commands in emacs style:
+ cnoremap <C-A> <Home>
+ cnoremap <C-F> <Right>
+ cnoremap <C-B> <Left>
+" cnoremap <C-E> <End>
+ cnoremap <ESC>b <S-Left>
+ cnoremap <ESC>f <S-Right>
+ cnoremap <ESC><C-H> <C-W>
+"
+" Additional codes for that "English" keyboard at the Xterminal
+ cnoremap <ESC>[D <S-Left>
+ cnoremap <ESC>[C <S-Right>
+"
+" Some editing is helpful in insert mode, too:
+ inoremap <C-F> <Right>
+ inoremap <C-B> <Left>
+"
+" Make the up and down movements move by "display/screen lines":
+" map j gj
+" map <Down> gj
+" map k gk
+" map <Up> gk
+"
+" ===================================================================
+" VIM - Editing and updating the vimrc:
+" As I often make changes to this file I use these commands
+" to start editing it and also update it:
+ if has("unix")
+ let vimrc='~/.vimrc'
+ else
+" ie: if has("dos16") || has("dos32") || has("win32")
+ let vimrc='$VIM\_vimrc'
+ endif
+ nn ,u :source <C-R>=vimrc<CR><CR>
+ nn ,v :edit <C-R>=vimrc<CR><CR>
+" ,v = vimrc editing (edit this file)
+" map ,v :e ~/.vimrc<CR>
+" ,u = "update" by reading this file
+" map ,u :source ~/.vimrc<CR>
+" ===================================================================
+"
+" General Editing
+"
+" Define "del" char to be the same backspace (saves a LOT of trouble!)
+" As the angle notation cannot be use with the LeftHandSide
+" with mappings you must type this in *literally*!
+ map <C-V>127 <C-H>
+ cmap <C-V>127 <C-H>
+" the same for Linux Debian which uses
+ imap <Esc>[3~ <C-H>
+ imap \7f <C-H>
+"
+" ;rcm = remove "control-m"s - for those mails sent from DOS:
+ cmap ;rcm %s/<C-M>//g
+"
+" Make whitespace visible:
+" Sws = show whitespace
+ nmap ,Sws :%s/ /_/g<C-M>
+ vmap ,Sws :%s/ /_/g<C-M>
+"
+" Sometimes you just want to *see* that trailing whitespace:
+" Stws = show trailing whitespace
+ nmap ,Stws :%s/ *$/_/g<C-M>
+ vmap ,Stws :%s/ *$/_/g<C-M>
+"
+" General Editing - Turning umlauts into ascii (for German keyboards)
+"
+" imap ä ae
+" imap ö oe
+" imap ü ue
+" imap ß ss
+"
+" Ä -> Ä :%s/\Ä/Ä/gc -> D
+" Ö -> Ö :%s/\Ö/Ö/gc -> V
+" Ü -> Ü :%s/\Ü/Ü/gc -> \
+" ä -> ä :%s/\ä/ä/gc -> d
+" ö -> ö :%s/\ö/ö/gc -> v
+" ü -> ü :%s/\ü/ü/gc -> |
+"
+" ===================================================================
+" Inserting Dates and Times / Updating Date+Time Stamps
+" ===================================================================
+" ,L = "Last updated" - replace old time stamp with a new one
+" preserving whitespace and using internal "strftime" command:
+" requires the abbreviation "YDATE"
+ map ,L 1G/Last update:\s*/e+1<CR>CYDATE<ESC>
+ map ,,L 1G/Last change:\s*/e+1<CR>CYDATE<ESC>
+" Example:
+" before: "Last update: Thu Apr 6 12:07:00 CET 1967"
+" after: "Last update: Tue Dec 16 12:07:00 CET 1997"
+"
+" ,L = "Last updated" - replace old time stamp with a new one
+" using external "date" command (not good for all systems):
+" map ,L 1G/Last update: */e+1<CR>D:r!date<CR>kJ
+"
+" ===================================================================
+" General Editing - link to program "screen"
+" ===================================================================
+"
+" ,Et = edit temporary file of "screen" program
+ map ,Et :e /tmp/screen-exchange
+" as a user of Unix systems you *must* have this program!
+" see also: http://www.math.fu-berlin.de/~guckes/screen/
+"
+" Email/News - Editing replies/followups
+"
+" Part 1 - prepare for editing
+"
+" Part 2 - getting rid of empty (quoted) lines and space runs.
+"
+" ,cel = "clear empty lines"
+" - delete the *contents* of all lines which contain only whitespace.
+" note: this does not delete lines!
+" map ,cel :g/^[<C-I> ]*$/d
+ map ,cel :%s/^\s\+$//
+" ,del = "delete 'empty' lines"
+" - delete all lines which contain only whitespace
+" note: this does *not* delete empty lines!
+ map ,del :g/^\s\+$/d
+"
+" ,cqel = "clear quoted empty lines"
+" Clears (makes empty) all lines which start with '>'
+" and any amount of following spaces.
+" nmap ,cqel :%s/^[> ]*$//
+" vmap ,cqel :s/^[> ]*$//
+" nmap ,cqel :%s/^[><C-I> ]\+$//
+" vmap ,cqel :s/^[><C-I> ]\+$//
+ nmap ,cqel :%s/^[>]\+$//
+ vmap ,cqel :s/^[><C-I> ]\+$//
+" NOTE: If the meta sequence "\s"
+" The following do not work as "\s" is not a character
+" and thus cannot be part of a "character set".
+" map ,cqel :g/^[>\s]\+$/d
+"
+" Some people have strange habits within their writing.
+" But if you cannot educate them - rewrite their text! ;-)
+"
+" Jason "triple-dots" King elephant@onaustralia.com.au
+" does uses ".." or "..." rather than the usual punctuation
+" (comma, semicolon, colon, full stop). So...
+"
+" Turning dot runs with following spaces into an end-of-sentence,
+" ie dot-space-space:
+ vmap ,dot :s/\.\+ \+/. /g
+"
+" Gary Kline (kline@tera.tera.com) indents his
+" own text in replies with TAB or spaces.
+" Here's how to get rid of these indentation:
+ vmap ,gary :s/^>[ <C-I>]\+\([^>]\)/> \1/
+"
+" ,ksr = "kill space runs"
+" substitutes runs of two or more space to a single space:
+" nmap ,ksr :%s/ */ /g
+" vmap ,ksr :s/ */ /g
+ nmap ,ksr :%s/ \+/ /g
+ vmap ,ksr :s/ \+/ /g
+" Why can't the removal of space runs be
+" an option of "text formatting"? *hrmpf*
+"
+" ,Sel = "squeeze empty lines"
+" Convert blocks of empty lines (not even whitespace included)
+" into *one* empty line (within current visual):
+ map ,Sel :g/^$/,/./-j
+"
+" ,Sbl = "squeeze blank lines"
+" Convert all blocks of blank lines (containing whitespace only)
+" into *one* empty line (within current visual):
+" map ,Sbl :g/^\s*$/,/[^ <c-i>]/-j
+" map ,Sbl :g/^\s*$/,/[^ \t]/-j
+ map ,Sbl :g/^\s*$/,/\S/-j
+"
+" ===================================================================
+" Editing of email replies and Usenet followups - using autocommands
+" ===================================================================
+"
+" Remove ALL auto-commands. This avoids having the
+" autocommands twice when the vimrc file is sourced again.
+" autocmd!
+"
+" Let Vim identify itself when editing emails with Mutt:
+" au! BufNewFile mutt* let @"="X-Editor: Vim-".version." http://www.vim.org\n"|exe 'norm 1G}""P'
+"
+" set the textwidth to 70 characters for replies (email&usenet)
+" au BufNewFile,BufRead .letter,mutt*,nn.*,snd.* set tw=78
+"
+" Try to use the mapping ",D" when doing a followup.
+" autocmd BufNewFile ~/.followup ,D|
+"
+" Part 3 - Change Quoting Level
+"
+" ,dp = de-quote current inner paragraph
+" map ,dp {jma}kmb:'a,'bs/^> //<CR>
+ map ,dp vip:s/^> //<CR>
+ vmap ,dp :s/^> //<CR>
+"
+" ,qp = quote current paragraph
+" jump to first inner line, mark with 'a';
+" jump to last inner line, mark with 'b';
+" then do the quoting as a substitution
+" on the line range "'a,'b":
+" map ,qp {jma}kmb:'a,'bs/^/> /<CR>
+" vim-5 now has selection of "inner" and "all"
+" of current text object - mapping commented!
+"
+" ,qp = quote current paragraph (old version)
+" jump to first inner line, Visual,
+" jump to last inner line,
+" then do the quoting as a substitution:
+" map ,qp {jV}k:s/^/> /<CR>
+"
+" ,qp = quote current inner paragraph (works since vim-5.0q)
+" select inner paragraph
+" then do the quoting as a substitution:
+ map ,qp vip:s/^/> /<CR>
+"
+" ,qp = quote current paragraph
+" just do the quoting as a substitution:
+ vmap ,qp :s/^/> /<CR>
+
+"
+" Changing quote style to *the* true quote prefix string "> ":
+"
+" Fix Supercite aka PowerQuote (Hi, Andi! :-):
+" before ,kpq: > Sven> text
+" after ,kpq: > > text
+" ,kpq kill power quote
+ vmap ,kpq :s/^> *[a-zA-Z]*>/> >/<C-M>
+"
+" Fix various other quote characters:
+" ,fq "fix quoting"
+ vmap ,fq :s/^> \([-":}\|][ <C-I>]\)/> > /
+"
+" Part 4 - Weed Headers of quoted mail/post
+"
+" These mappings make use of the abbreviation that define a list of
+" Email headers (HEMAIL) and News headers (HNEWS):
+ nmap ,we vip:v/HEMAIL/d
+ vmap ,we :v/HEMAIL/d
+ nmap ,wp vip:v/HNEWS/d
+ vmap ,wp :v/HNEWS/d
+"
+" Old versions for vim-4.6:
+" ,we = "weed email header"
+" nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
+" vmap ,we !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
+" ,wp = "weed post header"
+" nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
+" vmap ,wp !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
+"
+" ,ri = "Read in" basic lines from the email header
+" Useful when replying to an email:
+" nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:"
+" NOTE: "readmsg" ships with the mailer ELM.
+"
+"
+" Part 5 - Reformatting Text
+"
+" NOTE: The following mapping require formatoptions to include 'r'
+" and "comments" to include "n:>" (ie "nested" comments with '>').
+"
+" Formatting the current paragraph according to
+" the current 'textwidth' with ^J (control-j):
+ imap <C-J> <c-o>gqap
+ map <C-J> gqap
+"
+" ,b = break line in commented text (to be used on a space)
+" nmap ,b dwi<CR>> <ESC>
+ nmap ,b r<CR>
+" ,j = join line in commented text
+" (can be used anywhere on the line)
+" nmap ,j Jxx
+ nmap ,j Vjgq
+"
+" ,B = break line at current position *and* join the next line
+" nmap ,B i<CR>><ESC>Jxx
+ nmap ,B r<CR>Vjgq
+"
+" ,,, break current line at current column,
+" inserting ellipsis and "filling space":
+" nmap ,,, ,,1,,2
+" nmap ,,1 a...X...<ESC>FXr<CR>lmaky$o<CC-R>"<ESC>
+" nmap ,,2 :s/./ /g<C-M>3X0"yy$dd`a"yP
+"
+"
+" ===================================================================
+" Edit your reply! (Or else!)
+" ===================================================================
+"
+" Part 6 - Inserting Special or Standard Text
+" Part 6a - The header
+
+" Add adresses for To: and Cc: lines
+"
+" ,ca = check alias (reads in expansion of alias name)
+" map ,ca :r!elmalias -f "\%v (\%n)"
+" ,Ca = check alias (reads in expansion of alias name)
+" map ,Ca :r!elmalias -f "\%n <\%v>"
+"
+" ,cc = "copy notice"
+" Insert a Cc line so that person will receive a "courtesy copy";
+" this tells the addressee that text is a copy of a public article.
+" This assumes that there is exactly one empty line after the first
+" paragraph and the first line of the second paragraph contains the
+" return address with a trailing colon (which is later removed).
+ map ,cc 1G}jyykPICc: <ESC>$x
+" map ,cc ma1G}jy/ writes<CR>'aoCc: <ESC>$p
+"
+" ,mlu = make letter urgent (by giving the "Priority: urgent")
+ map ,mlu 1G}OPriority: urgent<ESC>
+"
+" Fixing the From: line
+"
+" ,cS = change Sven's address.
+ map ,cS 1G/^From: Sven Guckes/e+2<CR>C<Amailv><ESC>
+" Used when replying as the "guy from vim".
+"
+" Fixing the Subject line
+"
+" Pet peeve: Unmeaningful Subject lines. Change them!
+" ,cs = change Subject: line
+ map ,cs 1G/^Subject: <CR>yypIX-Old-<ESC>-W
+" This command keeps the old Subject line in "X-Old-Subject:" -
+" so the recipient can still search for it and
+" you keep a copy for editing.
+"
+"
+" ,re : Condense multiple "Re:_" to just one "Re:":
+ map ,re 1G/^Sub<CR>:s/\(Re: \)\+/Re: /<CR>
+"
+" ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines:
+ map ,Re 1G/^Subject: <C-M>:s/Re: Re\[\([0-9]\+\)\]/Re[\1]/<C-M><C-A>
+"
+" Put parentheses around "visual text"
+" Used when commenting out an old subject.
+" Example:
+" Subject: help
+" Subject: vim - using autoindent (Re: help)
+"
+" ,) and ,( :
+ vmap ,( v`<i(<ESC>`>a)<ESC>
+ vmap ,) v`<i(<ESC>`>a)<ESC>
+"
+" Part 6 - Inserting Special or Standard Text
+" Part 6a - Start of text - saying "hello".
+"
+" ,hi = "Hi!" (indicates first reply)
+ map ,hi 1G}oHi!<CR><ESC>
+"
+" ,ha = "helloagain" (indicates reply to reply)
+ map ,ha 1G}oHello, again!<CR><ESC>
+"
+" ,H = "Hallo, Du!" (German equivalent of "hi!" for replies)
+ map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
+"
+"
+" Part 6 - Inserting Special or Standard Text
+" Part 6b - End of text - dealing with "signatures".
+"
+" remove signatures
+"
+" ,kqs = kill quoted sig (to remove those damn sigs for replies)
+" goto end-of-buffer, search-backwards for a quoted sigdashes
+" line, ie "^> -- $", and delete unto end-of-paragraph:
+ map ,kqs G?^> -- $<CR>d}
+" map ,kqs G?^> *-- $<CR>dG
+" ,kqs = kill quoted sig unto start of own signature:
+" map ,kqs G?^> *-- $<CR>d/^-- $/<C-M>
+"
+" ,aq = "add quote"
+" Reads in a quote from my favourite quotations:
+ nmap ,aq :r!agrep -d "^-- $" ~/.P/quotes/collection<ESC>b
+" see http://www.math.fu-berlin.de/~guckes/quotes/collection
+"
+" ,s = "sign" -
+" Read in signature file (requires manual completion):
+ nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS<S-Left>
+"
+" available as http://www.math.fu-berlin.de/~guckes/sig/SIGS
+"
+" ,S = signature addition of frequently used signatures
+ nmap ,SE :r!agrep -d "^-- $" comp.mail.elm ~/.P/sig/SIGS<S-Left>
+ nmap ,SM :r!agrep -d "^-- $" WOOF ~/.P/sig/SIGS<S-Left>
+ nmap ,SV :r!agrep -d "^-- $" IMproved ~/.P/sig/SIGS<S-Left>
+"
+" ,at = "add text" -
+" read in text file (requires manual completion):
+ nmap ,at :r ~/.P/txt/
+"
+" MUTT: Auto-kill signatures for replies
+" map ,kqs G?^> *-- $<C-M>dG
+" autocmd BufNewFile,BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs
+"
+" At the end of editing your reply you should check your spelling
+" with the spelling checker "ispell".
+" These mappings are from Lawrence Clapp lclapp@iname.com:
+" spellcheck the document -- skip quoted text
+" nmap <F5> :w ! grep -v '^>' \| spell<CR>
+" vmap <F5> :w ! grep -v '^>' \| spell<CR>
+" At home under Linux it looks something more like this:
+" nmap <F5> :w ! grep -v '^>' \| ispell -???<CR>
+"
+" Tell the recipient that I was replying to an old email of his:
+ ab SvenR Sven [finally takeing the time to reply to old emails]
+"
+" Toggles: [todo]
+"
+" toggle autoindent
+" toggle hlsearch
+" cycle textwidth between values 60, 70, 75, 80
+"
+" ===================================================================
+" HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML
+" ===================================================================
+" This has become quite big - so I moved it out to another file:
+" http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227]
+" source ~guckes/.P/vim/source/html.vim
+"
+" ===================================================================
+" LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX
+" ===================================================================
+" This has become quite big - so I moved it out to another file:
+" http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim
+" source ~guckes/.P/vim/source/latex.vim
+"
+" ===================================================================
+" PGP - encryption and decryption
+" ===================================================================
+"
+" encrypt
+ map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty'
+" decrypt
+ map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty'
+" sign
+ map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
+ map ;v :,/^-----END/w !pgp -m
+"
+" PGP - original mappings
+"
+" encrypt and sign (useful for mailing to someone else)
+"csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4'
+" sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4
+"
+" sign (useful for mailing to someone else)
+"csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
+" sh: map #2 :,$! pgp -fast +clear 2>/dev/tty
+"
+" decrypt
+"csh: map #3 :/^-----BEG/,/^-----END/!\
+" /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4'
+" sh: map #3 :/^-----BEG/,/^-----END/!\
+" pgp -f 2>/dev/tty^V|^V|sleep 4
+"
+" view (pages output, like more)
+"csh: map #4 :,/^-----END/w !pgp -m
+" sh: map #4 :,/^-----END/w !pgp -m
+"
+" encrypt alone (useful for encrypting for oneself)
+"csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4'
+" sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4
+"
+" Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says :
+" The significant feature is that stderr is redirected independently
+" of stdout, and it is redirected to /dev/tty which is a synonym for
+" the current terminal on Unix. I don't know why the ||sleep 4
+" stuff is there, but it is harmless so I left it. Since csh is such
+" junk, special rules are used if you are using it (tcsh, too).
+" ksh and bash should use the sh form. zsh, et al: consult your
+" manual. The #<num> format is used to map function keys. If your
+" terminal does not support the requested function key, use a
+" literal #<num>. Not all of the clones correctly support this.
+"
+" ===================================================================
+" Useful stuff. At least these are nice examples. :-)
+" ===================================================================
+"
+" ,t = transpose two characters: from aXb -> bXa
+" map ,t XplxhhPl
+" This macros shortened by one character by
+" Preben Guldberg c928400@student.dtu.dk
+" map ,t XpxphXp
+" map ,t xphXpxp
+"
+" make space move the cursor to the right - much better than a *beep*
+" nmap \ l
+"
+" ,E = execute line
+" map ,E 0/\$<CR>w"yy$:<C-R>y<C-A>r!<C-E>
+" This command excutes a shell command from the current line and
+" reads in its output into the buffer. It assumes that the command
+" starts with the fist word after the first '$' (the shell prompt
+" of /bin/sh). Try ",E" on that line, ie place the cursor on it
+" and then press ",E":
+" $ ls -la
+" Note: The command line commands have been remapped to tcsh style!!
+"
+"
+" ,dr = decode/encode rot13 text
+ vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m
+
+" Use this with an external "rot13" script:
+" " ,13 - rot13 the visual text
+" vmap ,13 :!rot13<CR>
+"
+" Give the URL under the cursor to Netscape
+" map ,net yA:!netscape -remote "openurl <C-R>""
+"
+"
+" ===================================================================
+" Mapping of special keys - arrow keys and function keys.
+" ===================================================================
+" Buffer commands (split,move,delete) -
+" this makes a little more easy to deal with buffers.
+" (works for Linux PCs in room 030)
+ map <F4> :split<C-M>
+ map <F5> :bp<C-M>
+ map <F6> :bn<C-M>
+ map <F12> :bd<C-M>
+"
+" Buffer commands (split,move,delete) -
+" for Mac keyboard (Performa 5200, US keyboard)
+"
+ map <ESC>[19~ :split<C-M>
+ map <ESC>[20~ :bp<C-M>
+ map <ESC>[23~ :bn<C-M>
+ map <ESC>[31~ :bd<C-M>
+"
+" Obvious mappings
+"
+" map <PageUp> <C-B>
+" map <PageDown> <C-F>
+"
+" Emacs style editing in insert mode
+" This is something I tried for a minute
+" and forgot about the minute after. ;-)
+"
+" imap <C-A> <ESC>0i
+" imap <C-B> <ESC>hi
+" imap <C-D> <ESC>xi
+" imap <C-E> <ESC>A
+" imap <C-F> <ESC>lli
+" imap <C-N> <ESC>jli
+" imap <C-P> <ESC>kli
+" imap <ESC>b <ESC>bi
+" imap <ESC>f <ESC>lWi
+"
+" Normal mode - tcsh style movements [960425]
+"
+" nmap <C-A> 0
+" nmap <C-B> h
+" nmap <C-D> x
+" nmap <C-E> $
+" nmap <C-F> l
+" nmap <ESC>b b
+" nmap <ESC>f w
+"
+" DOS keyboard mapping for cursor keys
+"
+" map <ESC>[A <Up>
+" map <ESC>[B <Down>
+" map <ESC>[C <Right>
+" map <ESC>[D <Left>
+" imap <ESC>[A <Up>
+" imap <ESC>[B <Down>
+" imap <ESC>[C <Right>
+" imap <ESC>[D <Left>
+"
+" DOS keyboard
+" "insert"
+" map <ESC>[1~ i
+" map <ESC>[1~ <insert>
+" "home"
+" map <ESC>[2~ ^
+" map <ESC>[2~ 0
+" map <ESC>[2~ <Home>
+" "pgup"
+" map <ESC>[3~ <C-B>
+" map <ESC>[3~ <PageUp>
+" "delete"
+" map <ESC>[4~ x
+" map <ESC>[4~ <Del>
+" "end"
+" map <ESC>[5~ $
+" map <ESC>[5~ <END>
+" "pgdn"
+" map <ESC>[6~ <C-F>
+" map <ESC>[6~ <PageDown>
+"
+" Keyboard mapping for cursor keys
+" [works for SUNs in Solarium (room 030) - 970815]
+"
+ map <ESC>OA <Up>
+ map <ESC>OB <Down>
+ map <ESC>OC <Right>
+ map <ESC>OD <Left>
+ imap <ESC>OA <Up>
+ imap <ESC>OB <Down>
+ imap <ESC>OC <Right>
+ imap <ESC>OD <Left>
+"
+" Keyboard mapping for cursor keys
+" [works for XTerminals - 970818]
+ map <ESC>[A <Up>
+ map <ESC>[B <Down>
+ map <ESC>[C <Right>
+ map <ESC>[D <Left>
+ imap <ESC>[A <Up>
+ imap <ESC>[B <Down>
+ imap <ESC>[C <Right>
+ imap <ESC>[D <Left>
+"
+" ===================================================================
+" AutoCommands
+" ===================================================================
+"
+" Autocommands are the key to "syntax coloring".
+" There's one command in your vimrc that should
+" load/source the file $VIM/syntax/syntax.vim
+" which contains the definition for colors and
+" the autocommands that load other syntax files
+" when necessary, ie when the filename matches
+" a given pattern, eg "*.c" or *".html".
+"
+" just load the main syntax file when Vim was compiled with "+syntax"
+ if has("syntax")
+ " define my own syntax file (to be sourced t the end of syntax.vim):
+ " let mysyntaxfile="~guckes/.P/vim/syntax/syntax.vim"
+ " URL: http://www.math.fu-berlin.de/~guckes/vim/syntax/syntax.vim
+ " The main/standard syntax file:
+ so $VIMRUNTIME/syntax/syntax.vim
+ "
+ " Use my own syntax file on "mail/news messages":
+ let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES
+" exe aucommand." source ~guckes/.P/vim/syntax/sven.vim"
+ "
+ hi! Comment term=bold ctermfg=cyan guifg=Blue
+ endif
+"
+"
+" EXAMPLE: Restricting mappings to some files only:
+" An autocommand does the macthign on the filenames -
+" but abbreviations are not expanded within autocommands.
+" Workaround: Use "exe" for expansion:
+" let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES
+" exe aucommand." :map ,hi 1G}oHi!<CR><ESC>"
+" exe aucommand." :map ,ha 1G}oHello, again!<CR><ESC>"
+" exe aucommand." :map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>"
+" exe aucommand." :map ,re 1G}oRe!<CR><ESC>"
+"
+" Automatically place the cursor onto the first line of the mail body:
+" autocmd BufNewFile,BufRead MAILNEWSFILES :normal 1G}j
+"
+" Toggle syntax coloring on/off with "__":
+" nn __ mg:if has("syntax_items")<Bar>syn clear<CR>else<Bar>syn on<CR>en<CR>`g
+" Note: It works - but the screen flashes are quite annoying. :-/
+"
+"
+" ===================================================================
+" EXAMPLES
+" ===================================================================
+"
+" Visualizing trailing whitespace:
+" :set hls
+" /\s\+$
+"
+" Toggling a numerical variable between two values.
+" Example: Switch the textwidth (tw) between values "70" and "80":
+" map \1 :let &tw = 150 - &tw<CR>
+"
+" Capitalizing the previously typed word,
+" returning to the previous position:
+" imap CAP <ESC>mzB~`za
+"
+" Uppercasing the previously typed word,
+" returning to the previous position:
+" imap CAP <ESC>mzvBU`za
+" imap CAP <ESC>mzBvaWU`za
+"
+" ===================================================================
+" TEMPORARY STUFF - TESTING THINGS
+" ===================================================================
+"
+" View a html document (or part of it) with lynx. You need
+" a system that supports the /def/fd/* file descriptors :-(
+"nmap ,ly :w !lynx -force_html /dev/fd/0<CR>
+"vmap ,ly :w !lynx -force_html /dev/fd/0<CR>
+"
+" Fri Jun 19 19:19:19 CEST 1998
+" Hi, Vikas! vikasa@att.com
+" The <Left> key produces the code "<Esc>OD" and Vikas wants to make
+" Vim jump back one word in normal mode, ie using the command 'b':
+" nmap <Esc>OD b
+" Works for me! :-)
+"
+" Some simple example of the "expand modifiers":
+" insert the current filename *with* path:
+ iab YPATHFILE <C-R>=expand("%:p")<cr>
+" insert the current filename *without* path:
+ iab YFILE <C-R>=expand("%:t:r")<cr>
+" insert the path of current file:
+ iab YPATH <C-R>=expand("%:h")<cr>
+"
+" #b = "browse" - send selected URL to Netscape
+ vmap #b y:!netscape -remote "openurl <C-R>""
+"
+" Toggle highlight search and report the current value:
+" map #1 :set hls!<cr>
+" map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3)<cr>
+" map ## #1#2
+"
+" Sorting current line containing a list of numbers
+" map ## :s/ /<C-M>/g<CR>vip!sort -n
+"
+" Replying to the mutt mailing list:
+" Remove header lines Cc: and Bcc: and insert [mutt] at the beginning
+" map ,MM 1G/^Cc:<CR>2dd}o[mutt]<CR>
+"
+" map ,U %s#<URL:\(.*\)>#<a href="\1"></a>#gc
+" map ,F {jma}kmb:'a,'b!sed -e "s/^>//"<C-V><C-V>|\
+" sed -f ~/.P/elm/scripts/weedout.sed
+" map ,mb ebi<CR><b><ESC>Ea</b><CR><ESC>dw
+"
+" stripping netscape bookmarks and making them list items
+" vmap ,ns :.,$s/^ *<DT><\(A.*"\) ADD.*">\(.*\)$/<li> <\1><C-M><C-I>\2/
+"
+" Jump to the last space before the 80th column.
+" map ,\| 80\|F
+"
+" extracting variable names from mutt's init.c
+" :%s/^.*"\([a-z0-9_]*\)".*$/\1/
+"
+" \<> = change to <> notation by substituting ^M and ^[
+" cab \<> s/<C-V><ESC>/<ESC>/gc<C-M>:s/<C-V><C-M>/<C-M>/gc<C-M>
+"
+" Changing the From_ line in pseudo mail folders to an appropriate
+" value - so you can read them with a mailer.
+" %s/^From /From guckes Thu Apr 6 12:07:00 1967/
+"
+" ===================================================================
+" ASCII tables - you may need them some day. Save them to a file!
+" ===================================================================
+"
+" ASCII Table - | octal value - name/char |
+"
+" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
+" |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si |
+" |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb|
+" |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us |
+" |040 sp |041 ! |042 " |043 # |044 $ |045 % |046 & |047 ' |
+" |050 ( |051 ) |052 * |053 + |054 , |055 - |056 . |057 / |
+" |060 0 |061 1 |062 2 |063 3 |064 4 |065 5 |066 6 |067 7 |
+" |070 8 |071 9 |072 : |073 ; |074 < |075 = |076 > |077 ? |
+" |100 @ |101 A |102 B |103 C |104 D |105 E |106 F |107 G |
+" |110 H |111 I |112 J |113 K |114 L |115 M |116 N |117 O |
+" |120 P |121 Q |122 R |123 S |124 T |125 U |126 V |127 W |
+" |130 X |131 Y |132 Z |133 [ |134 \ |135 ] |136 ^ |137 _ |
+" |140 ` |141 a |142 b |143 c |144 d |145 e |146 f |147 g |
+" |150 h |151 i |152 j |153 k |154 l |155 m |156 n |157 o |
+" |160 p |161 q |162 r |163 s |164 t |165 u |166 v |167 w |
+" |170 x |171 y |172 z |173 { |174 | |175 } |176 ~ |177 del|
+"
+" ===================================================================
+" ASCII Table - | decimal value - name/char |
+"
+" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
+" |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si |
+" |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb|
+" |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us |
+" |032 sp |033 ! |034 " |035 # |036 $ |037 % |038 & |039 ' |
+" |040 ( |041 ) |042 * |043 + |044 , |045 - |046 . |047 / |
+" |048 0 |049 1 |050 2 |051 3 |052 4 |053 5 |054 6 |055 7 |
+" |056 8 |057 9 |058 : |059 ; |060 < |061 = |062 > |063 ? |
+" |064 @ |065 A |066 B |067 C |068 D |069 E |070 F |071 G |
+" |072 H |073 I |074 J |075 K |076 L |077 M |078 N |079 O |
+" |080 P |081 Q |082 R |083 S |084 T |085 U |086 V |087 W |
+" |088 X |089 Y |090 Z |091 [ |092 \ |093 ] |094 ^ |095 _ |
+" |096 ` |097 a |098 b |099 c |100 d |101 e |102 f |103 g |
+" |104 h |105 i |106 j |107 k |108 l |109 m |110 n |111 o |
+" |112 p |113 q |114 r |115 s |116 t |117 u |118 v |119 w |
+" |120 x |121 y |122 z |123 { |124 | |125 } |126 ~ |127 del|
+"
+" ===================================================================
+" ASCII Table - | hex value - name/char |
+"
+" | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel|
+" | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si |
+" | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb|
+" | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us |
+" | 20 sp | 21 ! | 22 " | 23 # | 24 $ | 25 % | 26 & | 27 ' |
+" | 28 ( | 29 ) | 2a * | 2b + | 2c , | 2d - | 2e . | 2f / |
+" | 30 0 | 31 1 | 32 2 | 33 3 | 34 4 | 35 5 | 36 6 | 37 7 |
+" | 38 8 | 39 9 | 3a : | 3b ; | 3c < | 3d = | 3e > | 3f ? |
+" | 40 @ | 41 A | 42 B | 43 C | 44 D | 45 E | 46 F | 47 G |
+" | 48 H | 49 I | 4a J | 4b K | 4c L | 4d M | 4e N | 4f O |
+" | 50 P | 51 Q | 52 R | 53 S | 54 T | 55 U | 56 V | 57 W |
+" | 58 X | 59 Y | 5a Z | 5b [ | 5c \ | 5d ] | 5e ^ | 5f _ |
+" | 60 ` | 61 a | 62 b | 63 c | 64 d | 65 e | 66 f | 67 g |
+" | 68 h | 69 i | 6a j | 6b k | 6c l | 6d m | 6e n | 6f o |
+" | 70 p | 71 q | 72 r | 73 s | 74 t | 75 u | 76 v | 77 w |
+" | 78 x | 79 y | 7a z | 7b { | 7c | | 7d } | 7e ~ | 7f del|
+" ===================================================================
+"
+" ===================================================================
+" If your read this...
+" ===================================================================
+" ... then please send me an email! Thanks! --Sven guckes@vim.org
+" I have received some emails so far - thanks, folks!
+" Enjoy Vim! :-)
+" ===================================================================
+" Yet another example for an autocommand: [980616]
+" au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!"
+" ===================================================================
+" Last but not least...
+" =====================================================
+" The last line is allowed to be a "modeline" with my setup.
+" It gives vim commands for setting variable values that are
+" specific for editing this file. Used mostly for setting
+" the textwidth (tw) and the "shiftwidth" (sw).
+" Note that the colon within the value of "comments" needs to
+" be escaped with a backslash! (Thanks, Thomas!)
+" vim:tw=70 et sw=4 comments=\:\"
+
+hi Normal guibg=#000000 guifg=#FFFFFF
+set sw=2 ts=2 tw=0 wm=0 nowrap cindent
+set shellpipe=2>
+set comments=sr:/**,m:*\ ,e:*/,://,b:#,:%,:XCOMM,n:>,n:\:,fb:-
+
+augroup Perl
+ autocmd!
+ autocmd BufEnter *.pl set sw=2 ts=2 tw=0 wm=0 nowrap si
+augroup END
+
+augroup Email
+ autocmd!
+ autocmd BufEnter /var/tmp/pico.* set tw=70
+augroup END
+
+set expandtab
+set tabstop=4
+set shiftwidth=4
git://id.pley.net / dotfiles.git / commitdiff